PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_6C613A3D9.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 380aa    MW: 39841.4 Da    PI: 6.9334
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_6C613A3D9.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.24.9e-10114176163
                            XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                            eke kr rr   NRe+Ar   +R++a  +eL++kv+ L+++N+++kke e+  +e+ +l+  +
  Traes_5BL_6C613A3D9.1 114 EKEAKRLRRVLANRESARQTILRRQAIRDELARKVADLSSQNESMKKEKETVMQEYLTLQETN 176
                            89******************************************************9998766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-11114178IPR004827Basic-leucine zipper domain
PfamPF001709.8E-9114176IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.967116179IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.5E-5118183No hitNo description
SuperFamilySSF579592.44E-6118173No hitNo description
CDDcd147025.86E-14119169No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MSDRSGQRQC RRGVSGDVEL DAAMALANMA GVSGPAALPA VHPAAPQHGG SREEEEEELA  60
STRLSLELGK VGIQASCSSS SSAGCPSQQA RVAVAAPGGG GYGPRPRHTL TEAEKEAKRL  120
RRVLANRESA RQTILRRQAI RDELARKVAD LSSQNESMKK EKETVMQEYL TLQETNKQLK  180
EQVIAKTAEK APPPVVTSMD TTPPAEQRAE ATLSTAAPLD APPGPGFLYA TAGPSAVPVP  240
YVWGSWPGYH PNASNMGGGA STGHAPPLCF PPCAWYYPVV TDPHGSPATS YAQPLHETTS  300
GGASQGTGGG TAEEDTDDDP CSLTLGLDVD RKCATSAESG GSRAVAGERE RAVMAAEARK  360
RRKELTKMKQ THLGGRPGGE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1358363RKRRKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008669858.11e-108PREDICTED: actin cytoskeleton-regulatory complex protein pan1-like
TrEMBLW5FCW40.0W5FCW4_WHEAT; Uncharacterized protein
STRINGMLOC_22590.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP31653475
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.19e-18bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]